![Western Blot: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Western blot analysis of extracts of various cell lines, using beta I Tubulin Rabbit mAb (NBP3-15928) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-1C3J0-Western-Blot-NBP3-15928-img0004.jpg "Western Blot: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Western blot analysis of extracts of various cell lines, using beta I Tubulin Rabbit mAb (NBP3-15928) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, Rt, Bv, Ca, PmSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 2Z6P1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 352-451 of human beta I Tubulin (Q9H4B7). AVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TUBB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/16250.jpg)
![Immunocytochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/beta-III_Tubulin_MAB1195_Immunocytochemistry_6556.jpg)
![Immunohistochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/betaIII_Tubulin_MAB1195_Immunohistochemistry_22757.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for beta I Tubulin Antibody (NBP3-15928)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TUBB1 |
![Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of U-2 OS cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-1C3J0-Immunocytochemistry-Immunofluorescence-NBP3-15928-img0003.jpg "Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of U-2 OS cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of C6 cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-1C3J0-Immunocytochemistry-Immunofluorescence-NBP3-15928-img0001.jpg "Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of C6 cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of NIH-3T3 cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/beta-I-Tubulin-Antibody-1C3J0-Immunocytochemistry-Immunofluorescence-NBP3-15928-img0002.jpg "Immunocytochemistry/Immunofluorescence: beta I Tubulin Antibody (1C3J0) [NBP3-15928] - Immunofluorescence analysis of NIH-3T3 cells using beta I Tubulin Rabbit mAb (NBP3-15928) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Bioactivity Thrombopoietin/THPO [Unconjugated]](https://images.novusbio.com/images/protein/288-tpncf_recombinant-human-thrombopoietin-ns0-expressed-protein-cf-bioactivity-272020135047.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A IGFBP-1 [Biotin]](https://images.novusbio.com/images2/DATA_IGFBP1_DY871_ELISA_2250.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")