beta I + II Tubulin Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human beta I + II Tubulin. Peptide sequence: ALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQG The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TUBB1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for beta I + II Tubulin Antibody
Background
Tubulin is the major building block of microtubules. This intracellular, cylindrical filamentous structure is present in almost all eukaryotic cells. Microtubules function as structural and mobile elements in mitosis, intracellular transport, flagellar movement and the cytoskeleton. Except in the simplest eukaryotes, tubulin exists in all cells as a mixture of similar but not identical sets of alpha and beta tubulin polypeptides. Within either family, individual subunits diverge from each other (both within and across species) at less than 10% of the amino acid positions. The most extreme diversity is localized to the carboxy-terminal 15 residues. For beta-tubulin, five evolutionarily conserved isotype clones have been identified. These are almost totally conserved in the subunits utilized in the same cell types of different species with the exception of the hematopoietic beta tubulin which is highly divergent in sequence and which is not conserved between species. Research has been centered around the hypothesis that these beta tubulin isotypes contribute to unique functional properties. It has been reported that the different isotypes of tubulin differ from each other in their ability to polymerize into microtubules.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ce, Ch, ChHa, Hu, I, In, Mu, Po, Pm, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: All-Multi
Applications: ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Publications for beta I + II Tubulin Antibody (NBP2-83948) (0)
There are no publications for beta I + II Tubulin Antibody (NBP2-83948).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta I + II Tubulin Antibody (NBP2-83948) (0)
There are no reviews for beta I + II Tubulin Antibody (NBP2-83948).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for beta I + II Tubulin Antibody (NBP2-83948) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional beta I + II Tubulin Products
Research Areas for beta I + II Tubulin Antibody (NBP2-83948)
Find related products by research area.
|
Blogs on beta I + II Tubulin