![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01), clone 3F9-2C2.Lane 1: B2M transfected lysate(13.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0015.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01), clone 3F9-2C2.Lane 1: B2M transfected lysate(13.7 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, IHC, KD |
| Clone | 3F9-2C2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | B2M (AAH32589, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
| Specificity | B2M - beta-2-microglobulin |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | B2M |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.Use in Immunohistochemistry reported in scientific literature (PMID: 24736453). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for beta 2-Microglobulin Antibody (H00000567-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Immunocytochemistry-Immunofluorescence-H00000567-M01-img0009.jpg "Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Immunohistochemistry-Paraffin-H00000567-M01-img0011.jpg "Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.")
![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi ( Cat # H00000567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # H00000567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0012.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi ( Cat # H00000567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # H00000567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - B2M monoclonal antibody (M01), clone 3F9-2C2 Analysis of B2M expression in U-2 OS.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0014.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - B2M monoclonal antibody (M01), clone 3F9-2C2 Analysis of B2M expression in U-2 OS.")
![Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-Proximity-Ligation-Assay-H00000567-M01-img0007.jpg "Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Detection limit for recombinant GST tagged B2M is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/beta-2-Microglobulin-Antibody-3F9-2C2-ELISA-H00000567-M01-img0016.jpg "ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Detection limit for recombinant GST tagged B2M is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
