![Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining in human cerebral cortex and skeletal muscle tissues using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Immunohistochemistry-Paraffin-NBP1-88890-img0011.jpg "Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining in human cerebral cortex and skeletal muscle tissues using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP6V1B2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP6V1B2 |
![Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Western-Blot-NBP1-88890-img0013.jpg "Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.")
![Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88890-img0007.jpg "Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.")
![Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Immunohistochemistry-Paraffin-NBP1-88890-img0014.jpg "Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human cerebral cortex shows high expression.")
![Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Western-Blot-NBP1-88890-img0005.jpg "Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Western-Blot-NBP1-88890-img0006.jpg "Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/ATP6V1B2-Antibody-Immunohistochemistry-Paraffin-NBP1-88890-img0010.jpg "Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")