![Western Blot: ATP6V0B Antibody [H00000533-D01P] - Analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody.Lane 1: ATP6V0B transfected lysate(21.40 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ATP6V0B-Antibody-Western-Blot-H00000533-D01P-img0001.jpg "Western Blot: ATP6V0B Antibody [H00000533-D01P] - Analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody.Lane 1: ATP6V0B transfected lysate(21.40 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | ATP6V0B (NP_004038.1, 1 a.a. - 205 a.a.) full-length human protein. MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP6V0B |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP6V0B |
| Uniprot |
|
![Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/16390.jpg)
![Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Western_Blot_12720.jpg)
![Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Immunocytochemistry_12734.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")