Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC |
Epitope | ASAIVPCLSPPGSLV |
Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | ATF3 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Publications using NBP2-34489 | Applications | Species |
---|---|---|
Rotterman T, Haley-Johnson Z, Chopra T et al. Modulation of Central Synapse Remodelling after Remote Peripheral Injuries by the Ccl2-Ccr2 Axis and Microglia Available at SSRN 2023-05-24 | ||
Travis M. Rotterman, Zoë Haley-Johnson, Tana S. Pottorf, Tavishi Chopra, Ethan Chang, Shannon Zhang, William M. McCallum, Sarah Fisher, Haley Franklin, Myriam Alvarez, Timothy C. Cope, Francisco J. Alvarez Modulation of central synapse remodeling after remote peripheral injuries by the CCL2-CCR2 axis and microglia Cell reports 2024-03-08 [PMID: 38367237] | ||
Calvo PM, de la Cruz RR, Pastor AM, Alvarez FJ Preservation of KCC2 expression in axotomized abducens motoneurons and its enhancement by VEGF Brain structure & function 2023-05-01 [PMID: 37005931] (IHC-FrFl, Rat, Feline) | IHC-FrFl | Rat, Feline |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATF3 Antibody (NBP2-34489)Find related products by research area.
|
Chemotherapy-induced metastasis: An unexpected foe? By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che... Read full blog post. |
Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.