Aromatase Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CYP19A1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Aromatase Antibody
Background
Aromatase is a member of the cytochrome P450 superfamily, whose function is to produce estrogens by aromatizing androgens. The primary function of Aromatase is to convert androstenedione to estrone and testosterone to estradiol. This protein is also a key enzyme in steroidogenesis, specifically for the biosynthesis of estrogens. Because estrogens also promote certain cancers and other diseases, aromatase inhibitors are frequently used to treat such diseases. It also plays an important role in sexual differentiation, fertility, and carcinogenesis.
Aromatase is localized in the endoplasmic reticulum of the cell and its activity is regulated by tissue specific promoters that are in turn controlled by hormones, cytokines, and other factors. It can be found in many tissues reproductive tissues including gonads, brain, adipose tissue, placenta, blood vessels, skin, bone, endometrium as well as in tissue of endometriosis, uterine fibroids, breast cancer, and endometrial cancer.
Many environmental chemicals may influence aromatase activity and thereby disrupt endocrine function. The activity is increased by environmental factors such as age, obesity, insulin, gonadotropins, and alcohol but decreased by prolactin, anti-m llerian hormone, and smoking.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Aromatase Antibody (NBP2-48998) (0)
There are no publications for Aromatase Antibody (NBP2-48998).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aromatase Antibody (NBP2-48998) (0)
There are no reviews for Aromatase Antibody (NBP2-48998).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aromatase Antibody (NBP2-48998) (0)