Novus Biologicals products are now on bio-techne.com

Apolipoprotein A-I/ApoA1 Recombinant Protein Antigen

Images

 
There are currently no images for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Apolipoprotein A-I/ApoA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOA1.

Source: E. coli

Amino Acid Sequence: SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33468.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein A-I/ApoA1 Recombinant Protein Antigen

  • Alp-1
  • APOA1
  • Apo-AI
  • apoA-I
  • Apolipoprotein A1
  • Apolipoprotein AI
  • Apolipoprotein A-I
  • Brp-14
  • Ltw-1
  • Lvtw-1
  • MGC117399
  • Sep-1
  • Sep-2

Background

Apolipoprotein A1 (apo A1) is the major polypeptide of the human plasma high density lipoprotein (HDL). The structure and function of the apo A1 gene are of interest because of the inverse correlation shown between HDL levels and coronary heart disease (1). The 267 amino acid precursor initially undergoes intracellular co-translational proteolytic cleavage into proapoA-I. ProapoA-I is secreted from the cell and was isolated from thoracic duct lymph in the apoA-I1 isoform position. Results indicate that apo A1 is present in human plasma, and undergoes post-translational proteolytic cleavage to mature plasma apoA-I (2). Cleavage of this protein with cyanogen bromide yields four fragments designated in the order of elution from Bio-Gel P-30 as CNBr I, II, III, and IV (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16168
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB600-610
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NBP1-05950
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-52932
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB4124
Species: Hu
Applications: IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB

Publications for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP) (0)

There are no publications for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP) (0)

There are no reviews for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein A-I/ApoA1 Products

Research Areas for Apolipoprotein A-I/ApoA1 Protein (NBP2-33468PEP)

Find related products by research area.

Blogs on Apolipoprotein A-I/ApoA1

There are no specific blogs for Apolipoprotein A-I/ApoA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein A-I/ApoA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA1