Home » AKAP1 » AKAP1 Proteins » AKAP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

AKAP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

AKAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP1.

Source: E. coli

Amino Acid Sequence: EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58918.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AKAP1 Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein 1
  • a kinase anchor protein 1, mitochondrial
  • AKAP121
  • AKAP149AKAP 149
  • AKAP84
  • A-kinase anchor protein 1, mitochondrial
  • A-kinase anchor protein 149 kDa
  • A-kinase anchor protein, 149kD
  • D-AKAP1
  • D-AKAP-1
  • Dual specificity A-kinase-anchoring protein 1
  • dual-specificity A-kinase anchoring protein 1
  • MGC1807
  • PRKA1
  • protein kinase A anchoring protein 1
  • protein kinase A1
  • Protein kinase A-anchoring protein 1
  • protein kinase anchoring protein 1
  • S-AKAP84
  • SAKAP84AKAP
  • Spermatid A-kinase anchor protein 84

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKAP13 Antibody
NBP1-89163
Immunocytochemistry/ Immunofluorescence AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AKAP5 Antibody -
BSA Free
NBP2-92794
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Western Blot AKAP5 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AKAP12 Antibody
NBP1-89168
Immunocytochemistry/ Immunofluorescence AKAP12 Antibody
Western Blot AKAP12 Antibody
Immunohistochemistry-Paraffin AKAP12 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MYCBP Antibody
(2E9)
H00026292-M02
Immunocytochemistry/ Immunofluorescence MYCBP Antibody (2E9)
ELISA MYCBP Antibody (2E9)
Immunohistochemistry-Paraffin MYCBP Antibody (2E9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AKAP7 Antibody
NBP1-89170
Western Blot AKAP7 Antibody
Immunohistochemistry AKAP7 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PKA R2 Antibody
(OTI1F8)
NBP2-02520
Flow Cytometry PKA R2 Antibody (OTI1F8)
Flow Cytometry PKA R2 Antibody (OTI1F8)
Flow Cytometry PKA R2 Antibody (OTI1F8)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AKAP9 Antibody
NBP1-89166
Immunocytochemistry/ Immunofluorescence AKAP9 Antibody
Immunohistochemistry-Paraffin AKAP9 Antibody
Immunohistochemistry-Paraffin AKAP9 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKAP95/AKAP8
Antibody (3D4)
H00010270-M01
Immunocytochemistry/ Immunofluorescence AKAP95/AKAP8 Antibody (3D4)
Immunohistochemistry-Paraffin AKAP95/AKAP8 Antibody (3D4)
Immunoprecipitation AKAP95/AKAP8 Antibody (3D4)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKAP10 Antibody
(8C10)
H00011216-M04
Western Blot AKAP10 Antibody (8C10)
Immunohistochemistry-Paraffin AKAP10 Antibody (8C10)
Sandwich ELISA AKAP10 Antibody (8C10)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
AKAP4 Antibody
NBP1-89165
Immunohistochemistry-Paraffin AKAP4 Antibody
Immunohistochemistry-Paraffin AKAP4 Antibody
Immunohistochemistry-Paraffin AKAP4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB

Publications for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no publications for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no reviews for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP1 Products

Blogs on AKAP1

There are no specific blogs for AKAP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AKAP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP1