![Western Blot: ADSSL1 Antibody (2D12) [H00122622-M01] - ADSSL1 monoclonal antibody (M01), clone 2D12. Analysis of ADSSL1 expression in A-431.](http://images.novusbio.com/fullsize/ADSSL1-Antibody-2D12-Western-Blot-H00122622-M01-img0002.jpg "Western Blot: ADSSL1 Antibody (2D12) [H00122622-M01] - ADSSL1 monoclonal antibody (M01), clone 2D12. Analysis of ADSSL1 expression in A-431.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2D12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ADSSL1 (NP_689541.1, 369 a.a. ~ 436 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH |
| Specificity | Reacts with adenylosuccinate synthase like 1. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ADSSL1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against recombinant protein in western blot and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ADSSL1 Antibody (H00122622-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ADSSL1 Antibody (2D12) [H00122622-M01] - ADSSL1 monoclonal antibody (M01), clone 2D12. Analysis of ADSSL1 expression in human kidney.](http://images.novusbio.com/fullsize/ADSSL1-Antibody-2D12-Western-Blot-H00122622-M01-img0003.jpg "Western Blot: ADSSL1 Antibody (2D12) [H00122622-M01] - ADSSL1 monoclonal antibody (M01), clone 2D12. Analysis of ADSSL1 expression in human kidney.")
![Sandwich ELISA: ADSSL1 Antibody (2D12) [H00122622-M01] - Detection limit for recombinant GST tagged ADSSL1 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ADSSL1-Antibody-2D12-Sandwich-ELISA-H00122622-M01-img0001.jpg "Sandwich ELISA: ADSSL1 Antibody (2D12) [H00122622-M01] - Detection limit for recombinant GST tagged ADSSL1 is 0.1 ng/ml as a capture antibody.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot HAND1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAND1_AF3168_Western_Blot_20450.jpg)
![Immunocytochemistry HAND1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3168_human-hand1-affinity-purified-polyclonal-ab-immunocytochemistry-25820219229.jpg)
![Immunohistochemistry HAND2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3876_human-mouse-hand2-affinity-purified-polyclonal-ab-immunohistochemistry-2932023105112.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")