![Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Analysis in human testis and liver tissues using NBP1-89236 antibody. Corresponding ADNP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunohistochemistry-Paraffin-NBP1-89236-img0010.jpg "Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Analysis in human testis and liver tissues using NBP1-89236 antibody. Corresponding ADNP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, Rt, RbSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADNP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ADNP Antibody (NBP1-89236)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADNP |
![Western Blot: ADNP Antibody [NBP1-89236] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ADNP-Antibody-Western-Blot-NBP1-89236-img0008.jpg "Western Blot: ADNP Antibody [NBP1-89236] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: ADNP Antibody [NBP1-89236] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89236-img0009.jpg "Immunocytochemistry/Immunofluorescence: ADNP Antibody [NBP1-89236] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunohistochemistry-Paraffin-NBP1-89236-img0013.jpg "Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human prostate shows strong nuclear positivity in glandular cells.")
![Western Blot: ADNP Antibody [NBP1-89236] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/ADNP-Antibody-Western-Blot-NBP1-89236-img0007.jpg "Western Blot: ADNP Antibody [NBP1-89236] - Analysis in human cell line SH-SY5Y.")
![Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunohistochemistry-Paraffin-NBP1-89236-img0011.jpg "Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunohistochemistry-Paraffin-NBP1-89236-img0012.jpg "Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ADNP-Antibody-Immunohistochemistry-Paraffin-NBP1-89236-img0014.jpg "Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human liver shows no positivity in hepatocytes as expected.")
![NT-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NT-3 [Unconjugated]")
![Western Blot PACAP/ADCYAP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PACAP_AF6380_Western_Blot_10225.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")