![Western Blot: ACAA1 Antibody (CL2650) [NBP2-42380] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-251](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Western-Blot-NBP2-42380-img0001.jpg "Western Blot: ACAA1 Antibody (CL2650) [NBP2-42380] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-251")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL2650 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Epitope | GAIMARIAQFLSDIP |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ACAA1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ACAA1 Antibody (NBP2-42380)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of CACO-2 cells using the Anti-ACAA1 monoclonal antibody, showing specific staining in peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Immunocytochemistry-Immunofluorescence-NBP2-42380-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of CACO-2 cells using the Anti-ACAA1 monoclonal antibody, showing specific staining in peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Immunohistochemistry-NBP2-42380-img0005.jpg "Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human colon shows granular cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Immunohistochemistry-NBP2-42380-img0002.jpg "Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human colon shows granular cytoplasmic immunoreactivity in glandular cells.")
![Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Immunohistochemistry-NBP2-42380-img0003.jpg "Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.](http://images.novusbio.com/fullsize/ACAA1-Antibody-CL2650-Immunohistochemistry-NBP2-42380-img0004.jpg "Immunohistochemistry: ACAA1 Antibody (CL2650) [NBP2-42380] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")