![Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Western-Blot-H00000030-M01-img0011.jpg "Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3F11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD |
| Marker | Peroxisome Marker |
| Specificity | ACAA1 - acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase) (3F11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ACAA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ACAA1 Antibody (H00000030-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Immunocytochemistry-Immunofluorescence-H00000030-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on HeLa cell . Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Immunohistochemistry-Paraffin-H00000030-M01-img0006.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.")
![Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Analysis of ACAA1 expression in human liver.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Western-Blot-H00000030-M01-img0009.jpg "Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Analysis of ACAA1 expression in human liver.")
![Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11.Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Western-Blot-H00000030-M01-img0010.jpg "Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11.Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa).Lane 2: Non-transfected lysate.")
![Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-Western-Blot-H00000030-M01-img0012.jpg "Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.")
![ELISA: ACAA1 Antibody (3F11) [H00000030-M01] - Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ACAA1-Antibody-3F11-ELISA-H00000030-M01-img0007.jpg "ELISA: ACAA1 Antibody (3F11) [H00000030-M01] - Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
