ABCE1 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 320-599 of human ABCE1 (NP_002931.2). ENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ABCE1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ABCE1 Antibody - BSA Free
Background
ATP-binding cassette sub-family E member 1 (ABCE1) is a member of the ATP-binding cassette sub-family E, but is not a membrane transporter.
ABCE-1 interacts with RNASEL to inhibit its endoribonuclease activity, and antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. ABCE1 is activated by encephalomyocarditis virus (EMCV) and HIV-1, and recently it has been found to be essential for the assembly of immature immunodeficiency virus capsids.
ABCE1 antibodies are useful tools for HIV studies and research on the ATP-binding cassette families.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IHC
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Ye
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Publications for ABCE1 Antibody (NBP3-04959) (0)
There are no publications for ABCE1 Antibody (NBP3-04959).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ABCE1 Antibody (NBP3-04959) (0)
There are no reviews for ABCE1 Antibody (NBP3-04959).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ABCE1 Antibody (NBP3-04959) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ABCE1 Products
Research Areas for ABCE1 Antibody (NBP3-04959)
Find related products by research area.
|
Blogs on ABCE1