Home » ABCA2 » ABCA2 Proteins » ABCA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ABCA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ABCA2 Protein (NBP2-14249PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ABCA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA2.

Source: E. coli

Amino Acid Sequence: PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14249.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA2 Recombinant Protein Antigen

  • ABC2ATP-binding cassette, sub-family A, member 2
  • ATP-binding cassette 2
  • ATP-binding cassette sub-family A member 2
  • ATP-binding cassette transporter 2
  • ATP-binding cassette, sub-family A (ABC1), member 2
  • EC 3.6.3
  • EC 3.6.3.41
  • KIAA1062
  • MGC129761

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCA1 Antibody -
BSA Free
NB400-105
Dual RNAscope ISH-IHC ABCA1 Antibody - BSA Free
Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free
Western Blot ABCA1 Antibody - BSA Free
(7 Reviews)
(408 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ABCA3 Antibody
NBP1-89310
Immunohistochemistry-Paraffin ABCA3 Antibody
Immunohistochemistry-Paraffin ABCA3 Antibody
Immunohistochemistry-Paraffin ABCA3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ABCA4 Antibody
(3F4)
NBP1-30032
Knockout Validated ABCA4 Antibody (3F4)
Immunohistochemistry ABCA4 Antibody (3F4)
Knockout Validated ABCA4 Antibody (3F4)
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Frozen MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MRP4/ABCC4 Antibody
NB100-1471
Immunohistochemistry-Paraffin MRP4/ABCC4 Antibody
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin DYNC1H1 Antibody
Immunohistochemistry-Paraffin DYNC1H1 Antibody
Immunohistochemistry-Paraffin DYNC1H1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CNPase Antibody
(CL2887)
NBP2-46617
Immunohistochemistry CNPase Antibody (CL2887)
Immunohistochemistry CNPase Antibody (CL2887)
Immunohistochemistry-Paraffin CNPase Antibody (CL2887)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ABCA8 Antibody
NBP1-91641
Immunohistochemistry-Paraffin ABCA8 Antibody
Immunohistochemistry-Paraffin ABCA8 Antibody
Immunohistochemistry-Paraffin ABCA8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ABCA7 Antibody
(7A1-144)
NB400-163
Western Blot ABCA7 Antibody (7A1-144)
Flow Cytometry ABCA7 Antibody (7A1-144)
Western Blot ABCA7 Antibody (7A1-144)
Species: Mu
Applications: Flow, IHC, IHC-P, WB
Prohibitin 2
Antibody
NBP2-13754
Immunocytochemistry/ Immunofluorescence Prohibitin 2 Antibody
Immunohistochemistry-Paraffin Prohibitin 2 Antibody
Immunohistochemistry-Paraffin Prohibitin 2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DCTN3 Antibody
NBP1-52105
Immunohistochemistry-Paraffin DCTN3 Antibody
Immunohistochemistry-Paraffin DCTN3 Antibody
Western Blot DCTN3 Antibody
(1 Publication)
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
Immunocytochemistry/ Immunofluorescence Calcium-binding-protein-P22 Antibody
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
ABCG1 Antibody -
BSA Free
NB400-132
Western Blot ABCG1 Antibody - BSA Free
Western Blot ABCG1 Antibody - BSA Free
Western Blot ABCG1 Antibody - BSA Free
(2 Reviews)
(182 Publications)
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, In vivo, WB
TAP1 Antibody (3D4)
H00006890-M04
Flow Cytometry TAP1 Antibody (3D4)
Immunocytochemistry/ Immunofluorescence TAP1 Antibody (3D4)
(1 Review)
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(46 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
ABCA2 Recombinant
Protein Antigen
NBP2-14249PEP
ABCA2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ABCA2 Protein (NBP2-14249PEP) (0)

There are no publications for ABCA2 Protein (NBP2-14249PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA2 Protein (NBP2-14249PEP) (0)

There are no reviews for ABCA2 Protein (NBP2-14249PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA2 Protein (NBP2-14249PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA2 Products

Array NBP2-14249PEP

Research Areas for ABCA2 Protein (NBP2-14249PEP)

Find related products by research area.

Blogs on ABCA2

There are no specific blogs for ABCA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
ABCA1 Antibody - BSA Free
NB400-105
Western Blot: ABCG1 Antibody - BSA Free [NB400-132] - Cells were pretreated with 5 uM F12511 or 5 uM MG132 for 30 min and then exposed to 5 or 50 uM 24S-OHC for 6 h. Whole-cell lysates were immunoblotted with antibodies specific for ABCG1 or beta-actin. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285856/) licensed under a CC-BY license.
ABCG1 Antibody - BSA Free
NB400-132
Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
beta Amyloid Antibody (MOAB-2) - BSA Free
NBP2-13075

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCA2