Dysbindin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DTNBP1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Dysbindin Antibody - BSA Free
Background
Dysbindin encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P
Publications for Dysbindin Antibody (NBP1-85299) (0)
There are no publications for Dysbindin Antibody (NBP1-85299).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dysbindin Antibody (NBP1-85299) (0)
There are no reviews for Dysbindin Antibody (NBP1-85299).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dysbindin Antibody (NBP1-85299) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dysbindin Products
Research Areas for Dysbindin Antibody (NBP1-85299)
Find related products by research area.
|
Blogs on Dysbindin
![Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Western-Blot-NBP1-85299-img0005.jpg "Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85299-img0007.jpg "Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human liver shows negative positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Immunohistochemistry-Paraffin-NBP1-85299-img0015.jpg "Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human liver shows negative positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Immunohistochemistry-Paraffin-NBP1-85299-img0012.jpg "Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Immunohistochemistry-Paraffin-NBP1-85299-img0013.jpg "Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/Dysbindin-Antibody-Immunohistochemistry-Paraffin-NBP1-85299-img0014.jpg "Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.")
![Neuregulin-1/NRG1 Antibody (147724) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Neuregulin-1/NRG1 Antibody (147724) [Unconjugated]")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")