![Western Blot: ZBED4 Antibody [NBP2-13531] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/ZBED4-Antibody-Western-Blot-NBP2-13531-img0005.jpg "Western Blot: ZBED4 Antibody [NBP2-13531] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZBED4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Western_Blot_5161.jpg)
![Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Chromatin_Immunoprecipitation_11224.jpg)
![Simple Western SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Simple_Western_16676.jpg)
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZBED4 |
![Immunocytochemistry/Immunofluorescence: ZBED4 Antibody [NBP2-13531] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://images.novusbio.com/fullsize/ZBED4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13531-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZBED4 Antibody [NBP2-13531] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.")
![Immunohistochemistry-Paraffin: ZBED4 Antibody [NBP2-13531] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/ZBED4-Antibody-Immunohistochemistry-Paraffin-NBP2-13531-img0001.jpg "Immunohistochemistry-Paraffin: ZBED4 Antibody [NBP2-13531] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.")
![Western Blot: ZBED4 Antibody [NBP2-13531] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/ZBED4-Antibody-Western-Blot-NBP2-13531-img0004.jpg "Western Blot: ZBED4 Antibody [NBP2-13531] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4")
![Immunocytochemistry NeuroD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NeuroD1_AF2746_Immunocytochemistry_7291.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")