Home » ZAK » ZAK Proteins » Recombinant Human ZAK GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human ZAK GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: ZAK Recombinant Protein [H00051776-P01]
SDS-Page: ZAK Recombinant Protein [H00051776-P01]
Functional: Recombinant Human ZAK Protein [H00051776-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP, Enzyme Activity

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human ZAK GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-455 of Human ZAK

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEESNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGKKVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZAK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Kinase Assay
  • Protein Array
  • Western Blot
Theoretical MW
75.79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZAK GST (N-Term) Protein

  • AZK
  • EC 2.7.11
  • EC 2.7.11.25
  • HCCS-4
  • Human cervical cancer suppressor gene 4 protein
  • Leucine zipper- and sterile alpha motif-containing kinase
  • mitogen-activated protein kinase kinase kinase MLT
  • mixed lineage kinase 7
  • mixed lineage kinase with a leucine zipper and a sterile alpha motif
  • mixed lineage kinase-related kinase MRK-beta
  • Mixed lineage kinase-related kinase
  • MLK7
  • mlklak
  • MLK-like mitogen-activated protein triple kinase
  • MLK-related kinase
  • MLT
  • MLTK
  • MRKcervical cancer suppressor gene 4 protein
  • pk
  • protein kinase
  • sterile alpha motif and leucine zipper containing kinase AZK
  • Sterile alpha motif- and leucine zipper-containing kinase AZK

Background

ZAK( AAH01401, 1 a.a. - 456 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PBR Antibody
NB100-41398
Flow Cytometry PBR Antibody
Immunocytochemistry/ Immunofluorescence PBR Antibody
Immunocytochemistry/ Immunofluorescence PBR Antibody
(13 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin Kininogen Antibody
Immunohistochemistry-Paraffin Kininogen Antibody
Western Blot Kininogen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Plasma
Kallikrein/KLKB1 Anti ...
AF2498
Plasma Kallikrein/KLKB1 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IP, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PP14/Glycodelin
Antibody
NBP1-89781
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Western Blot PP14/Glycodelin Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Knockdown Validated Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
C4 binding protein
A Antibody
NBP1-88262
Western Blot C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CARD14 Antibody -
Azide and BSA Free
NBP2-92873
Western Blot CARD14 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Lyp/PTPN22
Antibody [Unconjugate
AF3428
Western Blot Lyp/PTPN22 Antibody [Unconjugated]
Simple Western Lyp/PTPN22 Antibody [Unconjugated]
Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for ZAK Recombinant Protein (H00051776-P01) (0)

There are no publications for ZAK Recombinant Protein (H00051776-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZAK Recombinant Protein (H00051776-P01) (0)

There are no reviews for ZAK Recombinant Protein (H00051776-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZAK Recombinant Protein (H00051776-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZAK Products

Array H00051776-P01

Research Areas for ZAK Recombinant Protein (H00051776-P01)

Find related products by research area.

Blogs on ZAK

There are no specific blogs for ZAK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZAK GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ZAK