Home » WARS2 » WARS2 Proteins » WARS2 Recombinant Protein Antigen

WARS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for WARS2 Recombinant Protein Antigen (NBP3-17325PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

  • Loading...
Novus Biologicals offers 100% Guarantee
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

WARS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WARS2

Source: E. coli

Amino Acid Sequence: VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17325.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WARS2 Recombinant Protein Antigen

  • (Mt)TrpRS
  • EC 6.1.1
  • EC 6.1.1.2
  • TrpRStryptophan-tRNA ligase
  • tryptophan tRNA ligase 2, mitochondrial
  • Tryptophan--tRNA ligase
  • tryptophanyl tRNA synthetase 2, mitochondrial
  • tryptophanyl-tRNA synthetase, mitochondrial

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tryptophanyl tRNA
synthetase Antibody ( ...
NBP3-33363
Western Blot Tryptophanyl tRNA synthetase Antibody (1C6K8)
•••
Species: Hu
Applications: ELISA, IHC, IHC-P
TYRP1 Antibody -
BSA Free
NBP1-88370
Western Blot TYRP1 Antibody - BSA Free
•••
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WARS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol WARS2