![Western Blot: USP9Y Antibody [NBP3-16073] - Western blot analysis of extracts of various cell lines, using USP9Y antibody (NBP3-16073) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/USP9Y-Antibody-Western-Blot-NBP3-16073-img0004.jpg "Western Blot: USP9Y Antibody [NBP3-16073] - Western blot analysis of extracts of various cell lines, using USP9Y antibody (NBP3-16073) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9Y (NP_004645.2). YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP9Y |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
| Publication using NBP3-16073 | Applications | Species |
|---|---|---|
| Gelfand B, Argyle D, Olivieri J, Ambati J Survey of commercial antibodies targeting Y chromosome-encoded genes bioRxiv 2023-07-28 (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP9Y |
![Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded rat kidney using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/USP9Y-Antibody-Immunohistochemistry-Paraffin-NBP3-16073-img0003.jpg "Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded rat kidney using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse kidney using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/USP9Y-Antibody-Immunohistochemistry-Paraffin-NBP3-16073-img0001.jpg "Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse kidney using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse testis using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/USP9Y-Antibody-Immunohistochemistry-Paraffin-NBP3-16073-img0002.jpg "Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse testis using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of PC-12 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16073_rabbit-usp9y-pab-7220251245394.jpg "Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of PC-12 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of 293T cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16073_rabbit-usp9y-pab-72202512435330.jpg "Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of 293T cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of HepG2 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16073_rabbit-usp9y-pab-72202512432063.jpg "Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of HepG2 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of NIH/3T3 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16073_rabbit-usp9y-pab-72202512443322.jpg "Immunocytochemistry/ Immunofluorescence: USP9Y Antibody - Azide and BSA Free [NBP3-16073] - Immunofluorescence analysis of NIH/3T3 cells using USP9Y Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")