Home » USF1 » USF1 Proteins » USF1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

USF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for USF1 Recombinant Protein Antigen (NBP2-55392PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

USF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to USF1.

Source: E. coli

Amino Acid Sequence: IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
USF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55392.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USF1 Recombinant Protein Antigen

  • BHLHB11
  • bHLHb11FCHL1
  • Class B basic helix-loop-helix protein 11
  • FCHL
  • HYPLIP1
  • Major late transcription factor 1
  • MLTF
  • MLTFI
  • UEF
  • upstream stimulatory factor 1
  • upstream transcription factor 1
  • USF

Background

USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

USF2 Antibody
NBP1-92649
Western Blot USF2 Antibody
Immunohistochemistry-Paraffin USF2 Antibody
Knockout Validated USF2 Antibody
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KO, WB
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
FSHR Antibody
(6E8.2F5) - BSA Free
NBP2-36489
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Max Antibody
NB100-793
Immunohistochemistry-Paraffin Max Antibody
Immunofluorescence Max Antibody
Immunofluorescence Max Antibody
(3 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DNASE1 Antibody
NBP1-84999
Immunohistochemistry-Paraffin DNASE1 Antibody
Western Blot DNASE1 Antibody
Immunohistochemistry-Paraffin DNASE1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA

Publications for USF1 Recombinant Protein Antigen (NBP2-55392PEP) (0)

There are no publications for USF1 Recombinant Protein Antigen (NBP2-55392PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USF1 Recombinant Protein Antigen (NBP2-55392PEP) (0)

There are no reviews for USF1 Recombinant Protein Antigen (NBP2-55392PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USF1 Recombinant Protein Antigen (NBP2-55392PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USF1 Products

Research Areas for USF1 Recombinant Protein Antigen (NBP2-55392PEP)

Find related products by research area.

Blogs on USF1

There are no specific blogs for USF1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY license.
Fatty Acid Synthase/FASN Antibody
NB400-114

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our USF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol USF1