![Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection against Immunogen (35.53 KDa) .](http://images.novusbio.com/fullsize/UGT2B7-Antibody-8D12-Western-Blot-H00007364-M02-100ug-img0004.jpg "Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection against Immunogen (35.53 KDa) .")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 8D12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | UGT2B7 (NP_001065, 69 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | UGT2B7 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for UGT2B7 Antibody (H00007364-M02-100ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12. Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/UGT2B7-Antibody-8D12-Western-Blot-H00007364-M02-100ug-img0002.jpg "Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12. Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa). Lane 2: Non-transfected lysate.")
![Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.](http://images.novusbio.com/fullsize/UGT2B7-Antibody-8D12-Western-Blot-H00007364-M02-100ug-img0003.jpg "Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.")
![ELISA: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/UGT2B7-Antibody-8D12-ELISA-H00007364-M02-100ug-img0001.jpg "ELISA: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.")
