![Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-912202415175250.jpg "Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 9J6L2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TXNDC12 (NP_056997.1). Sequence: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEP |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TXNDC12 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 19 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TXNDC12 Antibody (NBP3-33549)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TXNDC12 |
![Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Mouse stomach using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-912202414154384.jpg "Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Mouse stomach using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Rat brain using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-91220241581299.jpg "Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Rat brain using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-912202415161835.jpg "Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-912202415152861.jpg "Immunohistochemistry: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using TXNDC12 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-1012202414049.jpg "Western Blot: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
![Western Blot: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.](http://images.novusbio.com/fullsize/nbp3-33549_rabbit-txndc12-mab-9j6l2-1012202414048.jpg "Western Blot: TXNDC12 Antibody (9J6L2) [NBP3-33549] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.")
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![Immunohistochemistry DMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DMP-1_AF4386_Immunohistochemistry_6833.jpg)
![Immunohistochemistry DMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af4386_mouse-dmp-1-affinity-purified-polyclonal-ab-4120241240226.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")