Novus Biologicals products are now on bio-techne.com

TRRAP Recombinant Protein Antigen

Images

 
There are currently no images for TRRAP Recombinant Protein Antigen (NBP2-58076PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TRRAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRRAP.

Source: E. coli

Amino Acid Sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRRAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58076.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRRAP Recombinant Protein Antigen

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP
  • TRRAP

Background

The novel ATM-related protein TRRAP is an essential cofactor for the c-Myc and E2F oncoproteins. It is an adapter protein, which is found in various multiprotein chromatin complexes with histone acetyltransferase activity (HAT), which gives a specific tag for epigenetic transcription activation. TRRAP plays a central role in MYC (c-Myc) transcription activation, and also participates in cell transformation by MYC. It is required for TP53/p53-, E2F1- and E2F4-mediated transcription activation. It most likely acts by linking transcription factors such as E1A, MYC or E2F1 to HAT complexes such as STAGA thereby allowing transcription activation and it is probably not required in the steps following histone acetylation in processes of transcription activation. TRRAP may also be required for the mitotic checkpoint and normal cell cycle progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB

Publications for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)

There are no publications for TRRAP Recombinant Protein Antigen (NBP2-58076PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)

There are no reviews for TRRAP Recombinant Protein Antigen (NBP2-58076PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRRAP Products

Array NBP2-58076PEP

Research Areas for TRRAP Recombinant Protein Antigen (NBP2-58076PEP)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRRAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRRAP