What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?

Name: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Brand: Novus Biologicals
SKU: NBP2-29331
Price: 559 USD

Question

What is the advantage of NBP2-26245 over NBP2-29331?  Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?

Accepted Answer

While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this.  1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875.  All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, MuSpecies Glossary
Concentration	LYOPH

Description	TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Immunogen	Functions as a TIRAP decoy by binding to TIR interacting domains on specific TLR receptors.
Specificity	The TIRAP inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable. The control peptide consists of only the PTD sequence.
Preparation Method	Preparation of 5 mM Stock Solutions PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. TIRAP Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS. Add 54 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing. Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing. Recipe for 1X PBS: 1. Dissolve the following in 800ml distilled H2O. - 8g of NaCl - 0.2g of KCl - 1.44g of Na2HPO4 - 0.24g of KH2PO4 2. Adjust pH to 7.5 with HCl. 3. Adjust volume to 1L with additional distilled H2O. 4. Sterilize by autoclaving
Content	TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Gene	TIRAP

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).
Concentration	LYOPH
Reconstitution Instructions	Please contact technical support for detailed reconstitution instructions.

Publications using NBP2-29331	Applications	Species
Higgins MJ, Serrano A, Boateng KY et al. A Multifaceted Role for Myd88-Dependent Signaling in Progression of Murine Mammary Carcinoma. Breast Cancer (Auckl). 2016-11-04 [PMID: 27812285] (In vitro, Mouse)	In vitro	Mouse
Brown GT, McIntyre TM. Lipopolysaccharide signaling without a nucleus: kinase cascades stimulate platelet shedding of proinflammatory IL-1B-rich microparticles. J Immunol. 2011-05-01 [PMID: 21430222] Details: TIRAP (IMG-2006-1), MyD88 (IMG-2005), and TRAF6 (IMG-2002) Inhibitory Peptide Sets. FA: Human and mouse blood platelets treated with or without LPS, soluble CD14, inhibitory peptides, and LBP. Readout assay: real time-PCR, Fig 2 & 6.
Scott MJ, Billiar TR. Beta2-integrin-induced p38 MAPK activation is a key mediator in the CD14/TLR4/MD2-dependent uptake of lipopolysaccharide by hepatocytes. J Biol Chem. 2008-10-24 [PMID: 18701460] (Mouse) Details: 1. MyD88 (IMG-2005): MyD88 peptide inhibition (mouse WT hepatocytes), Figs. 4A,D. 2. TIRAP (IMG-2006): TIRAP peptide inhibition (mouse WT hepatocytes), Figs. 4B,D; 5B; 6E.		Mouse
Liang S, Wang M, Tapping RI et al. Ganglioside GD1a is an essential coreceptor for Toll-like receptor 2 signaling in response to the B subunit of type IIb enterotoxin. J Biol Chem. 2007-03-09 [PMID: 17227759]

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Species Glossary

Images

Product Details

Order Details

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)(4)

Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331) (0)

Product General Protocols

FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331). (Showing 1 - 1 of 1 FAQs).

Additional TIRAP (TLR2 and TLR4) Products

Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-29331)

Blogs on TIRAP (TLR2 and TLR4)

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Bioinformatics