Home » Thrombospondin-1 » Thrombospondin-1 Proteins » Thrombospondin-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Thrombospondin-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Thrombospondin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thrombospondin-1.

Source: E. coli

Amino Acid Sequence: LTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THBS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56694.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thrombospondin-1 Recombinant Protein Antigen

  • THBS
  • THBS1
  • THBS-1
  • thrombospondin 1
  • Thrombospondin1
  • Thrombospondin-1
  • thrombospondin-1p180
  • TSP-1
  • TSP1thrombospondin-1
  • TSPTSP-1

Background

Thrombospondin is a protein from platelet a granules. It is secreted at sites of platelet activation and aggregation and is involved in the differentiation of leukocytes, fibroblasts, smooth muscle and endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(682 Publications)
Species: Hu
Applications: ELISA
Thrombospondin-2
[Unconjugated]
1635-T2
Bioactivity Thrombospondin-2 [Unconjugated]
(10 Publications)
Species: Hu
Applications: BA
CD47 Antibody
[Unconjugated]
AF4670
Western Blot CD47 Antibody [Unconjugated]
Neutralization CD47 Antibody [Unconjugated]
Immunohistochemistry CD47 Antibody [Unconjugated]
(4 Reviews)
(14 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(128 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(547 Publications)
Species: Hu
Applications: BA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Von Willebrand
Factor Antibody
NB600-586
Dual RNAscope ISH-IHC Von Willebrand Factor Antibody
Immunohistochemistry-Frozen Von Willebrand Factor Antibody
Immunohistochemistry Von Willebrand Factor Antibody
(3 Reviews)
(14 Publications)
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(660 Publications)
Species: Mu
Applications: ELISA
CTGF/CCN2 Antibody
[Unconjugated] - C-te ...
AF660
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus
(7 Publications)
Species: Hu
Applications: IHC
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(494 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
SPARC Antibody
[Unconjugated]
AF942
Western Blot SPARC Antibody [Unconjugated]
Immunohistochemistry SPARC Antibody [Unconjugated]
Immunocytochemistry SPARC Antibody [Unconjugated]
(38 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB

Publications for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP) (0)

There are no publications for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP) (0)

There are no reviews for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thrombospondin-1 Products

Research Areas for Thrombospondin-1 Recombinant Protein Antigen (NBP2-56694PEP)

Find related products by research area.

Blogs on Thrombospondin-1.

Check out the latest blog posts on Thrombospondin-1.
AHR - A transcription factor regulating immunity and tumorigenesis
The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thrombospondin-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol THBS1