![Western Blot: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Analysis in human cell lines PC-3 and MCF-7 using Anti-TXNRD1 antibody. Corresponding TXNRD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/Thioredoxin-Reductase-1-TRXR1-Antibody-Western-Blot-NBP1-81791-img0012.jpg "Western Blot: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Analysis in human cell lines PC-3 and MCF-7 using Anti-TXNRD1 antibody. Corresponding TXNRD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TXNRD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
| Publication using NBP1-81791 | Applications | Species |
|---|---|---|
| Capitanio D, Barbacini P, Arosio B et al. Can Serum Nitrosoproteome Predict Longevity of Aged Women? International Journal of Molecular Sciences 2020-11-27 [PMID: 33260845] (Western Blot) | Western Blot |
Secondary Antibodies |
Isotype Controls |
Research Areas for Thioredoxin Reductase 1/TRXR1 Antibody (NBP1-81791)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TXNRD1 |
![Immunohistochemistry-Paraffin: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells and basal cells in the seminiferous ducts.](http://images.novusbio.com/fullsize/Thioredoxin-Reductase-1-TRXR1-Antibody-Immunohistochemistry-Paraffin-NBP1-81791-img0011.jpg "Immunohistochemistry-Paraffin: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells and basal cells in the seminiferous ducts.")
![Western Blot: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/Thioredoxin-Reductase-1-TRXR1-Antibody-Western-Blot-NBP1-81791-img0006.jpg "Western Blot: Thioredoxin Reductase 1/TRXR1 Antibody [NBP1-81791] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue")
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")