TBR1 Recombinant Protein Antigen

Name: TBR1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-62728PEP
Price: 279 USD

Images

There are currently no images for TBR1 Recombinant Protein Antigen (NBP2-62728PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

TBR1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBR1. Source: E. coli Amino Acid Sequence: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TBR1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10-100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62728. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TBR1 Recombinant Protein Antigen

MGC141978
T-box brain protein 1
T-box, brain, 1
TBR-1
T-brain-1
TES-56

Background

TBR1 - T-box, brain, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EOMES Antibody

AF6166

Intracellular Staining by Flow Cytometry EOMES Antibody

(26 Publications)

Species: Hu

Applications: CyTOF-ready, ICC, ICFlow, WB

Reelin Antibody
[Unconjugated]

AF3820

(23 Publications)

Species: Mu

Applications: IHC, WB

Pax6 Antibody
[Unconjugated]

AF8150

Immunocytochemistry Pax6 Antibody [Unconjugated]

Western Blot Pax6 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: ICC, ICFlow, Simple Western, WB

CSN3 Antibody -
BSA Free

NBP1-85436

Species: Hu

Applications: IHC, IHC-P

CASK Antibody -
BSA Free

NBP2-41181

Immunocytochemistry/ Immunofluorescence CASK Antibody - BSA Free

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, Simple Western, WB

Neurogenin-2
Antibody (7G4) [Uncon ...

MAB3314

(14 Publications)

Species: Hu, Rt

Applications: IHC

Guanylate kinase
Antibody (OTI4A8)

NBP2-00594

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

BCL11B Antibody

NB100-2600

Immunohistochemistry-Paraffin BCL11B Antibody

(1 Review)

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P

CINAP Antibody

NBP1-52123

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA

GAD1/GAD67
Antibody [Unconjugate

AF2086

Western Blot GAD1/GAD67 Antibody [Unconjugated]

Simple Western GAD1/GAD67 Antibody [Unconjugated]

(13 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

NeuroD1 Antibody
[Unconjugated]

AF2746

(18 Publications)

Species: Hu, Mu

Applications: ICC, WB

ZNF312 Antibody -
Azide and BSA Free

NBP2-94378

Species: Hu, Rt

Applications: WB

ASCL1/Mash1
Antibody [Unconjugate

AF2567

(3 Publications)

Species: Mu

Applications: IHC, WB

SATB2 Antibody -
BSA Free

NBP1-83619

(4 Publications)

Species: Hu

Applications: IHC, IHC-P, Simple Western, WB

Neuropilin-1
Antibody [Unconjugate

AF566

Western Blot Neuropilin-1 Antibody [Unconjugated]

(10 Reviews)

(109 Publications)

Species: Mu, Rt

Applications: Block, CyTOF-ready, Flow, IHC, WB

TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...

NBP2-44501

Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IF, IHC, IHC-P

BDNF [HRP]

DBD00

(104 Publications)

Species: Hu

Applications: ELISA

Calretinin
Antibody - BSA Free

NBP1-88220

Western Blot Calretinin Antibody - BSA Free

Immunohistochemistry-Paraffin Calretinin Antibody - BSA Free

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

TAF9 Antibody -
BSA Free

NBP2-41266

Immunocytochemistry/ Immunofluorescence TAF9 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

T-bet/TBX21
Antibody (39D) - BSA

NBP1-43299

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no publications for TBR1 Recombinant Protein Antigen (NBP2-62728PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no reviews for TBR1 Recombinant Protein Antigen (NBP2-62728PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBR1 Products

Research Areas for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Find related products by research area.

Blogs on TBR1.

Check out the latest blog posts on TBR1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (hippocampus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.

Neuropilin-1 Antibody [Unconjugated]
AF566

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TBR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TBR1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TBR1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TBR1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TBR1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

Reviews for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

FAQs for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

Additional TBR1 Products

Research Areas for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Blogs on TBR1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics