Novus Biologicals products are now on bio-techne.com

TBC1D4 Recombinant Protein Antigen

Name: TBC1D4 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38460PEP
Price: 279 USD

Images

There are currently no images for TBC1D4 Protein (NBP2-38460PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TBC1D4 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBC1D4. Source: E. coli Amino Acid Sequence: VTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQGEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERILEDSGFDEQQE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TBC1D4
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38460. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TBC1D4 Recombinant Protein Antigen

Akt substrate of 160 kDa
AS160Acrg embryonic lethality minimal region ortholog
DKFZp779C0666
KIAA0603TBC (Tre-2, BUB2, CDC16) domain-containing protein
TBC1 domain family member 4
TBC1 domain family, member 4

Background

AS160, also known as TBC1D4, is a 160 kDa Akt substrate that plays a critical role in regulating insulin-stimulated exocytosis of glucose transporter GLUT4. AS-160 contains a Rab GTPase-activating protein domain (GAP), suggesting its potential role in membrane trafficking. Insulin-stimulated phosphorylation of AS160 on threonine 642 is critical for mediating GLUT4 translocation in fat and muscle cells, via inactivation of Rab GAP function. Phosphorylation of Thr642 is also important in mediating TBC1D4 redistribution from low density microsomes to the cytosol in adipocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glut4 Antibody -
BSA Free

NBP1-49533

(4 Reviews)

(41 Publications)

Species: Hu, Mu, Pl, Rt

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

AMPK alpha 2
Antibody [Unconjugate

AF2850

Simple Western AMPK alpha 2 Antibody [Unconjugated]

Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

AMPK alpha 1
Antibody (2B7) - BSA

NBP2-22127

ELISA AMPK alpha 1 Antibody (2B7) - BSA Free

(12 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

AMPK beta 1
Antibody [Unconjugate

AF2854

Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

PYK2/FAK2 [p
Tyr402] Antibody (592 ...

MAB6210

Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]

(1 Review)

(1 Publication)

Species: Hu

Applications: Simple Western, WB

TBC1D1 Antibody

NBP1-54654

Immunohistochemistry-Paraffin TBC1D1 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

IRS1 Antibody

NB100-82001

Immunocytochemistry/ Immunofluorescence IRS1 Antibody

(4 Publications)

Species: Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Leucyl-cystinyl
Aminopeptidase/LNPEP ...

AF6386

Species: Hu

Applications: IP, WB

Insulin Receptor
beta Antibody

NBP2-12793

Immunoprecipitation Insulin Receptor beta Antibody

(1 Review)

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

TOR/mTOR [p
Ser2448] Antibody

NB600-607

Western Blot TOR/mTOR [p Ser2448] Antibody

(2 Reviews)

(9 Publications)

Species: Hu, Rt

Applications: ELISA, IHC, IHC-P, WB

ATIC Antibody

NBP1-89192

Immunohistochemistry-Paraffin ATIC Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

14-3-3 Antibody

NBP2-27202

Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody

(1 Review)

Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt

Applications: ICC/IF, Simple Western, WB

Glut1 Antibody -
BSA Free

NB110-39113

Flow Cytometry Glut1 Antibody - BSA Free

(7 Reviews)

(62 Publications)

Species: Hu, Mu, Rb, Rt

Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB

RPL6 Antibody

NBP2-20216

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

MED10 Antibody

NBP1-81328

Immunocytochemistry/ Immunofluorescence MED10 Antibody

Species: Hu

Applications: ICC/IF, WB

TM4SF1/L6 Antibody
(877621) [Unconjugate ...

MAB8164

Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]

(2 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, IHC

Publications for TBC1D4 Protein (NBP2-38460PEP) (0)

There are no publications for TBC1D4 Protein (NBP2-38460PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D4 Protein (NBP2-38460PEP) (0)

There are no reviews for TBC1D4 Protein (NBP2-38460PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TBC1D4 Protein (NBP2-38460PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBC1D4 Products

Research Areas for TBC1D4 Protein (NBP2-38460PEP)

Find related products by research area.

Blogs on TBC1D4

There are no specific blogs for TBC1D4, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.

Glut1 Antibody - BSA Free
NB110-39113

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TBC1D4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TBC1D4

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TBC1D4 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TBC1D4 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TBC1D4 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TBC1D4 Protein (NBP2-38460PEP) (0)

Reviews for TBC1D4 Protein (NBP2-38460PEP) (0)

FAQs for TBC1D4 Protein (NBP2-38460PEP) (0)

Additional TBC1D4 Products

Research Areas for TBC1D4 Protein (NBP2-38460PEP)

Blogs on TBC1D4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics