Home » SRY » SRY Proteins » Recombinant Human SRY GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SRY GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human SRY Protein [H00006736-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human SRY Protein [H00006736-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human SRY GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-204 of Human SRY full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SRY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
50.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006736-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRY GST (N-Term) Protein

  • essential protein for sex determination in human males
  • sex determining region Y
  • sex-determining region on Y
  • sex-determining region Y protein
  • TDFsex determining region protein
  • TDY
  • Testis-determining factor

Background

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(145 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ZFY Antibody
NBP2-57923
Immunocytochemistry/ Immunofluorescence ZFY Antibody
Species: Hu
Applications: ICC/IF
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(49 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
WT1 Antibody
(6F-H2) - BSA Free
NB110-60011
Western Blot WT1 Antibody (6F-H2) - BSA Free
Immunohistochemistry-Paraffin WT1 Antibody (6F-H2) - BSA Free
Western Blot WT1 Antibody (6F-H2) - BSA Free
(3 Reviews)
(14 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Recombinant Human
TSPY1 GST (N-Term) Pr ...
H00007258-Q01
SDS-PAGE Recombinant Human TSPY1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Wnt-4 Antibody
AF475
Wnt-4 Antibody
(1 Review)
(12 Publications)
Species: Mu
Applications: IHC, WB
Splicing Factor 1
Antibody (2E12)
H00007536-M01
Western Blot Splicing Factor 1 Antibody (2E12)
Western Blot Splicing Factor 1 Antibody (2E12)
Immunocytochemistry/ Immunofluorescence Splicing Factor 1 Antibody (2E12)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(353 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DAZ1 Antibody
(3G10)
H00001617-M01
Western Blot DAZ1 Antibody (3G10)
Immunocytochemistry/ Immunofluorescence DAZ1 Antibody (3G10)
Immunohistochemistry-Paraffin DAZ1 Antibody (3G10)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SOX3 Antibody
[Unconjugated]
AF2569
Immunocytochemistry SOX3 Antibody [Unconjugated]
Immunocytochemistry SOX3 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
RBMY1A1 Antibody
NBP1-32887
Immunohistochemistry-Paraffin RBMY1A1 Antibody
Western Blot RBMY1A1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FGF-9
[Unconjugated]
273-F9
Bioactivity FGF-9 [Unconjugated]
(44 Publications)
Species: Hu
Applications: BA
MIS/AMH
[Unconjugated]
1737-MS/CF
MIS/AMH [Unconjugated]
(17 Publications)
Species: Hu
Applications: Bind

Publications for SRY Recombinant Protein (H00006736-P01)(1)


Reviews for SRY Recombinant Protein (H00006736-P01) (0)

There are no reviews for SRY Recombinant Protein (H00006736-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRY Recombinant Protein (H00006736-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRY Products

Array H00006736-P01

Blogs on SRY

There are no specific blogs for SRY, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
SOX9 Antibody [Unconjugated]
AF3075
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRY GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SRY