SRY Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
SRY (NP_003131.1, 1 a.a. - 204 a.a.) full-length human protein. MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL |
Specificity |
SRY - sex determining region Y, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
SRY |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 10ug/mL
- Western Blot 1:500
|
Application Notes |
It has been used for WB, ELISA and IF. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SRY Antibody
Background
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Publications for SRY Antibody (H00006736-B01P) (0)
There are no publications for SRY Antibody (H00006736-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SRY Antibody (H00006736-B01P) (0)
There are no reviews for SRY Antibody (H00006736-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SRY Antibody (H00006736-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SRY Products
Blogs on SRY