Novus Biologicals products are now on bio-techne.com

SPG3A Recombinant Protein Antigen

Name: SPG3A Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-90234PEP
Price: 279 USD

Images

There are currently no images for SPG3A Protein (NBP1-90234PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SPG3A Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATL1. Source: E. coli Amino Acid Sequence: IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ATL1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90234. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SPG3A Recombinant Protein Antigen

AD-FSP
ATL1
atlastin GTPase 1
atlastin1
atlastin-1
Brain-specific GTP-binding protein
EC 3.6.5.-
FSP1
GBP3
GBP-3
GTP-binding protein 3
Guanine nucleotide-binding protein 3
guanylate-binding protein 3
hGBP3
Spastic paraplegia 3 protein A
spastic paraplegia 3A (autosomal dominant)
SPG3
SPG3A
SPG3AhGBP3

Background

SPG3A is encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Spastin Antibody
(2F5)

H00006683-M02

Immunohistochemistry-Paraffin Spastin Antibody (2F5)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

S100A4 Antibody
(1F12-1G7)

H00006275-M01

(17 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, WB

SLC22A3 Antibody

NBP1-83976

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

ITK Antibody
(HL1264) - Azide and ...

NBP3-25538

Western Blot ITK Antibody (HL1264) - Azide and BSA Free

Immunohistochemistry-Paraffin ITK Antibody (HL1264) - Azide and BSA Free

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

REEP1 Antibody

NBP3-14647

Species: Hu

Applications: IHC-P, IP, WB

E-Cadherin
Antibody [Unconjugate

AF748

Immunohistochemistry E-Cadherin Antibody [Unconjugated]

(136 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB

Vimentin Antibody

NB300-223

Immunohistochemistry-Frozen Vimentin Antibody

(6 Reviews)

(70 Publications)

Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

HSP60 Antibody -
BSA Free

NBP1-77397

(4 Reviews)

(6 Publications)

Species: Hu, Mu

Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB

Kinesin 5A
Antibody - BSA Free

NBP1-76816

Western Blot Kinesin 5A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Kinesin 5A Antibody - BSA Free

(1 Review)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(808 Publications)

Species: Hu

Applications: BA

NIPA1 Antibody

NBP1-93476

Species: Hu

Applications: IHC, IHC-P

SPG7 Antibody
(OTI1C1)

NBP2-01860

(1 Review)

(3 Publications)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, WB

Reticulon 2
Antibody

NBP1-59662

Immunohistochemistry-Paraffin Reticulon 2 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

MMP-9 [HRP]

DMP900

(219 Publications)

Species: Hu

Applications: ELISA

GBP1 Antibody

NBP2-03972

Immunohistochemistry-Paraffin GBP1 Antibody

(1 Publication)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

SPG8 Antibody

NBP2-20471

Immunohistochemistry-Paraffin SPG8 Antibody

(1 Review)

Species: Hu

Applications: IHC, IHC-P, WB

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

SPG3A Recombinant
Protein Antigen

NBP1-90234PEP

Species: Hu

Applications: AC

Publications for SPG3A Protein (NBP1-90234PEP) (0)

There are no publications for SPG3A Protein (NBP1-90234PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPG3A Protein (NBP1-90234PEP) (0)

There are no reviews for SPG3A Protein (NBP1-90234PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SPG3A Protein (NBP1-90234PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPG3A Products

Blogs on SPG3A

There are no specific blogs for SPG3A, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our SPG3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ATL1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SPG3A Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

SPG3A Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for SPG3A Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SPG3A Protein (NBP1-90234PEP) (0)

Reviews for SPG3A Protein (NBP1-90234PEP) (0)

FAQs for SPG3A Protein (NBP1-90234PEP) (0)

Additional SPG3A Products

Blogs on SPG3A

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics