Reactivity | Hu, ZeSpecies Glossary |
Applications | WB, ELISA, ICC/IF |
Clone | 8F10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS |
Specificity | SMOC1 - SPARC related modular calcium binding 1 |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | SMOC1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00064093-M03 | Applications | Species |
---|---|---|
Mateus R, Holtzer L, Seum C et al. BMP Signaling Gradient Scaling in the Zebrafish Pectoral Fin. Cell Rep. 2020-03-24 [PMID: 32209485] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.