SLC5A11 Recombinant Protein Antigen

Name: SLC5A11 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-82862PEP
Price: 279 USD

Images

There are currently no images for SLC5A11 Protein (NBP1-82862PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC5A11 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC5A11. Source: E. coli Amino Acid Sequence: EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SLC5A11
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82862. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC5A11 Recombinant Protein Antigen

KST1RKST1
Na(+)/myo-inositol cotransporter 2
na+/myo-inositol cotransporter 2
putative sodium-coupled cotransporter RKST1
SGLT6
SLGTX
SMIT2homolog of rabbit KST1
Sodium/glucose cotransporter KST1
sodium/myo-inositol cotransporter 2
Sodium-dependent glucose cotransporter
solute carrier family 5 (sodium/glucose cotransporter), member 11
Solute carrier family 5 member 11

Background

Cotransporters, such as SLC5A11, represent a major class of proteins that make use of ion gradients to drive activetransport for the cellular accumulation of nutrients, neurotransmitters, osmolytes, and ions Roll et al. (2002)(PubMed 12039040).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SGLT1/SLC5A1
Antibody

NBP2-20338

Immunocytochemistry/ Immunofluorescence SGLT1/SLC5A1 Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

SLC5A3 Antibody -
BSA Free

NBP1-02399

(1 Publication)

Species: Bt, Bv, Ca, Ha, Hu, Pm, Rb

Applications: IHC, IHC-P

SGLT2/SLC5A2
Antibody

NBP1-92384

(2 Reviews)

(12 Publications)

Species: Ca, Hu, Mu, Tn

Applications: ICC/IF, IHC, IHC-P, WB

KAT1 Antibody
(7U2O3)

NBP3-16412

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Cysteine Conjugate
beta-Lyase/CCBL1 Anti ...

AF7817

Species: Hu, Mu, Rt

Applications: WB

SLC2A13 Antibody

NBP3-17114

Species: Hu

Applications: IHC, IHC-P, WB

Glut2 Antibody -
BSA Free

NBP2-22218

Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free

(2 Reviews)

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(819 Publications)

Species: Hu

Applications: BA

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(389 Publications)

Species: Hu, Mu

Applications: ICC, IHC

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(25 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Glut1 Antibody -
BSA Free

NB110-39113

Flow Cytometry Glut1 Antibody - BSA Free

(7 Reviews)

(62 Publications)

Species: Hu, Mu, Rb, Rt

Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB

IL-1ra/IL-1F3/IL1RN [H

DRA00B

(100 Publications)

Species: Hu

Applications: ELISA

Lymphotoxin-alpha/TNF- ...

211-TBB/CF

Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]

(8 Publications)

Species: Hu

Applications: BA

Sialin/SLC17A5
Antibody

NBP2-20383

Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

TLR4 Antibody
(76B357.1) - BSA Free

NB100-56566

Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free

(5 Reviews)

(141 Publications)

Species: Bv, Hu, Ma, Mu, Po, Rt

Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

MITF Antibody

AF5769

(9 Publications)

Species: Hu

Applications: IHC, WB

Complement
Component C2 Antibody ...

AF1936

(1 Publication)

Species: Hu

Applications: IP, WB

Tbp7 Antibody

NBP1-87799

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Proteasome 19S S3
Antibody (OTI2A2) - A ...

NBP2-73636

Flow Cytometry Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: CyTOF-ready, Flow, WB

SLC5A11
Recombinant Protein A

NBP1-82862PEP

Species: Hu

Applications: AC

Publications for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no publications for SLC5A11 Protein (NBP1-82862PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no reviews for SLC5A11 Protein (NBP1-82862PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC5A11 Protein (NBP1-82862PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC5A11 Products

Research Areas for SLC5A11 Protein (NBP1-82862PEP)

Find related products by research area.

Membrane Trafficking and Chaperones

Blogs on SLC5A11

There are no specific blogs for SLC5A11, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.

TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our SLC5A11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

SLC5A11

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SLC5A11 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

SLC5A11 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for SLC5A11 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SLC5A11 Protein (NBP1-82862PEP) (0)

Reviews for SLC5A11 Protein (NBP1-82862PEP) (0)

FAQs for SLC5A11 Protein (NBP1-82862PEP) (0)

Additional SLC5A11 Products

Research Areas for SLC5A11 Protein (NBP1-82862PEP)

Blogs on SLC5A11

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics