![Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human placenta shows strong membranous positivity in Hofbauer cells.](http://images.novusbio.com/fullsize/Siglec-1-CD169-Antibody-Immunohistochemistry-Paraffin-NBP2-30903-img0006.jpg "Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human placenta shows strong membranous positivity in Hofbauer cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, Dual ISH-IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SIGLEC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Siglec-1/CD169 Antibody (NBP2-30903)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human lung shows strong membranous positivity in macrophages.](http://images.novusbio.com/fullsize/Siglec-1-CD169-Antibody-Immunohistochemistry-Paraffin-NBP2-30903-img0004.jpg "Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human lung shows strong membranous positivity in macrophages.")
![Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human liver shows strong membranous positivity in Kupffer cells.](http://images.novusbio.com/fullsize/Siglec-1-CD169-Antibody-Immunohistochemistry-Paraffin-NBP2-30903-img0005.jpg "Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human liver shows strong membranous positivity in Kupffer cells.")
![Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Siglec-1-CD169-Antibody-Immunohistochemistry-Paraffin-NBP2-30903-img0007.jpg "Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody [NBP2-30903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunocytochemistry CRIPTO Antibody [Unconjugated]](https://images.novusbio.com/images2/Cripto_AF1538_Immunocytochemistry__Immunofluorescence_20121.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")