SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free Summary
Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
N
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).
Packaging, Storage & Formulations
Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from a 0.2 um filtered solution in PBS.
Preservative
No Preservative
Concentration
LYOPH
Purity
Protein G purified
Reconstitution Instructions
Reconstitute with sterilized PBS to a final concentration of 0.5 mg/ml.
Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free
COVID-19 nucleocapsid protein
N protein
N structural protein
N
NC
Nucleocapsid protein
Nucleoprotein
Protein N
SARS coronavirus N protein
SARS coronavirus nucleocapsid protein
SARS CoV N protein
SARS CoV nucleocapsid protein
SARS CoV
SARS N protein
SARS Nucleoprotein
SARSCoV N protein
SARSCoV nucleocapsid protein
SARSCoV
SARSCOV2 N protein
SARS-COV-2 nucleocapsid protein
SARS-COV-2 Nucleoprotein
Severe acute respiratory syndrome
Background
It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967)(3)
We have publications tested in 1 confirmed species: SARS-CoV-2.
We have publications tested in 2 applications: ELISA, IA.
Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967) (0)
There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free and receive a gift card or discount.
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")