![Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/RXR-alpha-NR2B1-Antibody-6Y10M1-Western-Blot-NBP3-15667-img0003.jpg "Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP, ChIP |
| Clone | 6Y10M1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXR alpha/NR2B1 (P19793). MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RXRA |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![RXR gamma/NR2B3 Antibody (H3210) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "RXR gamma/NR2B3 Antibody (H3210) [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for RXR alpha/NR2B1 Antibody (NBP3-15667)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RXRA |
![Immunocytochemistry/Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Immunofluorescence analysis of HeLa cells using RXR alpha/NR2B1 Rabbit mAb (NBP3-15667) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RXR-alpha-NR2B1-Antibody-6Y10M1-Immunocytochemistry-Immunofluorescence-NBP3-15667-img0001.jpg "Immunocytochemistry/Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Immunofluorescence analysis of HeLa cells using RXR alpha/NR2B1 Rabbit mAb (NBP3-15667) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using RXR alpha/NR2B1 antibody (NBP3-15667) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/RXR-alpha-NR2B1-Antibody-6Y10M1-Chromatin-Immunoprecipitation-NBP3-15667-img0005.jpg "Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using RXR alpha/NR2B1 antibody (NBP3-15667) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/RXR-alpha-NR2B1-Antibody-6Y10M1-Western-Blot-NBP3-15667-img0002.jpg "Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug RXR alpha/NR2B1 antibody (NBP3-15667). Western blot was performed from the immunoprecipitate using RXR alpha/NR2B1 antibody (NBP3-15667) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/RXR-alpha-NR2B1-Antibody-6Y10M1-Immunoprecipitation-NBP3-15667-img0004.jpg "Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug RXR alpha/NR2B1 antibody (NBP3-15667). Western blot was performed from the immunoprecipitate using RXR alpha/NR2B1 antibody (NBP3-15667) at a dilition of 1:1000.")
![Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Confocal imaging of HeLa cells using RXR alpha/NR2B1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15667_rabbit-rxr-alpha-nr2b1-mab-6y10m1-5220251731103.jpg "Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Confocal imaging of HeLa cells using RXR alpha/NR2B1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR alpha/NR2B1 (lower panel).](http://images.novusbio.com/fullsize/nbp3-15667_rabbit-rxr-alpha-nr2b1-mab-6y10m1-52202517344269.jpg "Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR alpha/NR2B1 (lower panel).")
![Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 in the representative genomic region surrounding ECH1 gene.](http://images.novusbio.com/fullsize/nbp3-15667_rabbit-rxr-alpha-nr2b1-mab-6y10m1-52202517315534.jpg "Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 in the representative genomic region surrounding ECH1 gene.")
![Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR alpha/NR2B1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/nbp3-15667_rabbit-rxr-alpha-nr2b1-mab-6y10m1-52202517352787.jpg "Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR alpha/NR2B1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")