Home » RKIP/PBP » RKIP/PBP Proteins » RKIP/PBP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RKIP/PBP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RKIP/PBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RKIP/PBP.

Source: E. coli

Amino Acid Sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68813.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RKIP/PBP Recombinant Protein Antigen

  • HCNP
  • HCNPpp
  • hippocampal cholinergic neurostimulating peptide
  • Neuropolypeptide h3
  • PBP
  • PBPPEBP-1
  • PEBP1
  • PEBP-1
  • PEBPHCNPpp
  • phosphatidylethanolamine binding protein 1
  • phosphatidylethanolamine-binding protein 1
  • prostatic binding protein
  • Prostatic-binding protein
  • Raf kinase inhibitory protein
  • RKIP
  • RKIPRaf kinase inhibitor protein

Background

PBP, also known as RKIP (RAF kinase inhibitor protein), binds ATP, opioids and phosphatidylethanolamine. PBP is able to regulate Aurora kinase B expression and the spindle checkpoint through interaction with the RAF1/MEK/ERK cascade. PBP is able to bind to RAF1 and MEK and competitively disrupt the interaction between these proteins. PBP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. It increases the production of choline acetyltransferase but not acetylcholinesterase. PBP has been implicated as a suppressor of metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
ZHX2 Antibody
NBP1-82956
Immunocytochemistry/ Immunofluorescence ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Mammaglobin A
Antibody (3C8) - BSA
NBP1-51671
Flow Cytometry Mammaglobin A Antibody (3C8) - BSA Free
Immunohistochemistry-Paraffin Mammaglobin A Antibody (3C8) - BSA Free
Western Blot Mammaglobin A Antibody (3C8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Uteroglobin/SCGB1A1 An ...
MAB4218
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: IHC, WB
CXCL7/NAP-2
[Biotin]
DY393
N/A CXCL7/NAP-2 [Biotin]
(18 Publications)
Species: Hu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TRAP220/MED1
Antibody
AF5520
Western Blot TRAP220/MED1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NHE6/SLC9A6
Antibody
NBP2-38877
Immunocytochemistry/ Immunofluorescence NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
GDI1 Antibody
NBP1-31528
Western Blot GDI1 Antibody
Western Blot GDI1 Antibody
Immunohistochemistry-Paraffin GDI1 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RKIP/PBP
Recombinant Protein A
NBP2-68813PEP
RKIP/PBP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP) (0)

There are no publications for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP) (0)

There are no reviews for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RKIP/PBP Products

Research Areas for RKIP/PBP Recombinant Protein Antigen (NBP2-68813PEP)

Find related products by research area.

Blogs on RKIP/PBP

There are no specific blogs for RKIP/PBP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RKIP/PBP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PEBP1