RIPK2 Antibody (2C7) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM |
Specificity |
RIPK2 (2C7) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
RIPK2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. |
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RIPK2 Antibody (2C7) - Azide and BSA Free
Background
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for RIPK2 Antibody (H00008767-M01) (0)
There are no publications for RIPK2 Antibody (H00008767-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RIPK2 Antibody (H00008767-M01) (0)
There are no reviews for RIPK2 Antibody (H00008767-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RIPK2 Antibody (H00008767-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RIPK2 Products
Research Areas for RIPK2 Antibody (H00008767-M01)
Find related products by research area.
|
Blogs on RIPK2