![Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining in human lymph node and skeletal muscle tissues using anti-RGS14 antibody. Corresponding RGS14 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RGS14-Antibody-Immunohistochemistry-Paraffin-NBP2-13227-img0007.jpg "Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining in human lymph node and skeletal muscle tissues using anti-RGS14 antibody. Corresponding RGS14 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP |
| Predicted Species | Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RGS14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RGS14 Antibody (NBP2-13227)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RGS14 |
![Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human lymph node shows moderate nuclear and cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/RGS14-Antibody-Immunohistochemistry-Paraffin-NBP2-13227-img0005.jpg "Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human lymph node shows moderate nuclear and cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/RGS14-Antibody-Immunohistochemistry-Paraffin-NBP2-13227-img0006.jpg "Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-13227] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")