Home » Rad17 » Rad17 Proteins » Rad17 Recombinant Protein Antigen

Rad17 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Rad17 Protein (NBP1-86561PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Rad17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD17.

Source: E. coli

Amino Acid Sequence: SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86561.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad17 Recombinant Protein Antigen

  • CCYC
  • cell cycle checkpoint protein (RAD17)
  • cell cycle checkpoint protein RAD17
  • FLJ41520
  • HRAD17
  • R24L
  • RAD1 (S. pombe) homolog
  • RAD1 homolog
  • RAD17 homolog (S. pombe)
  • Rad17
  • Rad17-like protein
  • RAD17SP
  • RAD24
  • RF-C activator 1 homolog
  • RF-C/activator 1 homolog

Background

Signals originating from damaged DNA activate checkpoint pathways and target the mitotic apparatus via a number a distinct mechanisms. These checkpoints link damage to DNA with the components of the cell cycle through signal transduction systems. In mammals, five genes have been identified as components of DNA damage-induced checkpoint pathways: ATM, p53, p21/WAF1/CIP1, hCHK1, and 14-3-3sigma. When overexpressed in mammalian cells, hRAD17 activates p53 and causes an accumulation of G1 phase cells, suggesting an involvement of the hRAD17 gene in this checkpoint pathway.(1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rad9 Antibody
(93A535) - BSA Free
NB120-13600
Western Blot Rad9 Antibody (93A535) - BSA Free
Immunohistochemistry-Paraffin Rad9 Antibody (93A535) - BSA Free
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western Blot Chk2 [p Thr68] Antibody [Unconjugated]
Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, WB
Rad1 Antibody (1G2)
H00005810-M01J
Western Blot Rad1 Antibody (1G2)
Western Blot Rad1 Antibody (1G2)
Immunohistochemistry-Paraffin Rad1 Antibody (1G2)
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
RRAD Antibody
NBP2-27500
Western Blot RRAD Antibody
(1 Publication)
Species: Mu
Applications: KO, PEP-ELISA, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(48 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry MMAB Antibody (OTI2G5)
Flow Cytometry MMAB Antibody (OTI2G5)
Western Blot MMAB Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATM Antibody (2C1)
NB100-309
Western Blot ATM Antibody (2C1)
Western Blot ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
XPF Antibody
(OTI4E11)
NBP2-01020
Flow Cytometry XPF Antibody (OTI4E11)
Western Blot XPF Antibody (OTI4E11)
Immunohistochemistry-Paraffin XPF Antibody (OTI4E11)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western Blot RFC1 Antibody [Unconjugated]
Species: Hu
Applications: WB
Reduced Folate
Carrier/SLC19A1 Antib
NBP1-59904
Immunohistochemistry-Paraffin Reduced Folate Carrier/SLC19A1 Antibody
Western Blot Reduced Folate Carrier/SLC19A1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HUS1 Antibody
NBP1-33589
Immunohistochemistry-Paraffin HUS1 Antibody
Western Blot HUS1 Antibody
Western Blot HUS1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PP2A alpha [p
Tyr307] Antibody [Unc ...
AF3989
Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(67 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
14-3-3 Antibody
NBP2-27202
Simple Western 14-3-3 Antibody
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody
Western Blot 14-3-3 Antibody
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Claspin Antibody
NB100-247
Western Blot Claspin Antibody
Immunoprecipitation Claspin Antibody
Immunohistochemistry-Paraffin Claspin Antibody
(13 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CHTF18 Antibody
(1F5)
H00063922-M01
Sandwich ELISA CHTF18 Antibody (1F5)
Western Blot CHTF18 Antibody (1F5)
Western Blot CHTF18 Antibody (1F5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for Rad17 Protein (NBP1-86561PEP) (0)

There are no publications for Rad17 Protein (NBP1-86561PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad17 Protein (NBP1-86561PEP) (0)

There are no reviews for Rad17 Protein (NBP1-86561PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad17 Protein (NBP1-86561PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad17 Products

Research Areas for Rad17 Protein (NBP1-86561PEP)

Find related products by research area.

Blogs on Rad17

There are no specific blogs for Rad17, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
ATM Antibody (2C1)
NB100-309
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad17 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RAD17