![Western Blot: PTGIR Antibody (2A7) [H00005739-M02] - Analysis of PTGIR expression in transfected 293T cell line by PTGIR monoclonal antibody (M02), clone 2A7.Lane 1: PTGIR transfected lysate(41 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PTGIR-Antibody-2A7-Western-Blot-H00005739-M02-img0003.jpg "Western Blot: PTGIR Antibody (2A7) [H00005739-M02] - Analysis of PTGIR expression in transfected 293T cell line by PTGIR monoclonal antibody (M02), clone 2A7.Lane 1: PTGIR transfected lysate(41 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2A7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC |
| Specificity | PTGIR - prostaglandin I2 (prostacyclin) receptor (IP) (2A7) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PTGIR |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PTGIR Antibody (H00005739-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: PTGIR Antibody (2A7) [H00005739-M02] - Detection limit for recombinant GST tagged PTGIR is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PTGIR-Antibody-2A7-Sandwich-ELISA-H00005739-M02-img0002.jpg "Sandwich ELISA: PTGIR Antibody (2A7) [H00005739-M02] - Detection limit for recombinant GST tagged PTGIR is approximately 0.1ng/ml as a capture antibody.")
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Simple Western Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]](https://images.novusbio.com/images2/PTGIS_MAB7788_Simple_Western_17148.jpg)
![Western Blot Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]](https://images.novusbio.com/images2/PTGIS_MAB7788_Western_Blot_13067.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")