![Immunocytochemistry/Immunofluorescence: PRAK Antibody [NBP1-87231] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/PRAK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87231-img0006.jpg "Immunocytochemistry/Immunofluorescence: PRAK Antibody [NBP1-87231] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAPKAPK5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87231 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRAK Antibody (NBP1-87231)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAPKAPK5 |
![Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PRAK-Antibody-Immunohistochemistry-Paraffin-NBP1-87231-img0010.jpg "Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PRAK-Antibody-Immunohistochemistry-Paraffin-NBP1-87231-img0007.jpg "Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human rectum shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PRAK-Antibody-Immunohistochemistry-Paraffin-NBP1-87231-img0008.jpg "Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PRAK-Antibody-Immunohistochemistry-Paraffin-NBP1-87231-img0009.jpg "Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.")
![Western Blot ERK3/MAPK6 Antibody (335102) [Unconjugated]](https://images.novusbio.com/images2/ERK3_MAB3196_Western_Blot_6069.jpg)
![Immunohistochemistry ERK3/MAPK6 Antibody (335102) [Unconjugated]](https://images.novusbio.com/images2/ERK3_MAB3196_Immunohistochemistry_6991.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Immunocytochemistry__Immunofluorescence_21057.jpg)
![Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Simple_Western_16621.jpg)
![Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Western_Blot_12767.jpg)
![Western Blot ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Western_Blot_5217.jpg)
![Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Immunocytochemistry__Immunofluorescence_19361.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")