Home » PLOD3 » PLOD3 Proteins » PLOD3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PLOD3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PLOD3 Protein (NBP1-81307PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PLOD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLOD3.

Source: E. coli

Amino Acid Sequence: FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLOD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81307.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLOD3 Recombinant Protein Antigen

  • 2-oxoglutarate 5-dioxygenase 3
  • EC 1.14.11.4
  • LH3Lysyl hydroxylase 3
  • lysine hydroxylase 3
  • procollagen-lysine
  • procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3

Background

PLOD3 is encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
Lysine Hydroxylase
2/PLOD2 Antibody
H00005352-B01P
Immunocytochemistry/ Immunofluorescence Lysine Hydroxylase 2/PLOD2 Antibody
Western Blot Lysine Hydroxylase 2/PLOD2 Antibody
Western Blot Lysine Hydroxylase 2/PLOD2 Antibody
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC/IF, WB
LHX2 Antibody
(CL6137)
NBP2-61435
Immunohistochemistry-Paraffin LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
GGT1 Antibody (1F9)
H00002678-M01
Western Blot GGT1 Antibody (1F9)
Immunohistochemistry-Paraffin GGT1 Antibody (1F9)
Immunoprecipitation GGT1 Antibody (1F9)
(10 Publications)
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
FABP6 Antibody
[Unconjugated]
AF3880
Immunocytochemistry FABP6 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
LOX Antibody
NB100-2527
Immunocytochemistry/ Immunofluorescence LOX Antibody
Immunohistochemistry LOX Antibody
Western Blot LOX Antibody
(5 Reviews)
(38 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MBL Antibody
AF2307
MBL Antibody
(9 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
GLT25D1 Antibody
NBP2-14619
Western Blot GLT25D1 Antibody
Immunohistochemistry-Paraffin GLT25D1 Antibody
Immunohistochemistry-Paraffin GLT25D1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Decorin Antibody
[Unconjugated]
AF1060
Simple Western Decorin Antibody [Unconjugated]
Western Blot Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
MEFV Antibody
NB600-809
Immunocytochemistry/ Immunofluorescence MEFV Antibody
Flow Cytometry MEFV Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA

Publications for PLOD3 Protein (NBP1-81307PEP) (0)

There are no publications for PLOD3 Protein (NBP1-81307PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLOD3 Protein (NBP1-81307PEP) (0)

There are no reviews for PLOD3 Protein (NBP1-81307PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLOD3 Protein (NBP1-81307PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLOD3 Products

Blogs on PLOD3

There are no specific blogs for PLOD3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLOD3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLOD3