PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

Images

 
There are currently no images for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HTM.

Source: E. coli

Amino Acid Sequence: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
P4HTM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83989.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

  • EC 1.14.11.-
  • EGLN4
  • HIFPH4
  • HIF-PH4
  • HIF-prolyl hydroxylase 4
  • HPH-4
  • hypoxia-inducible factor prolyl 4-hydroxylase
  • Hypoxia-inducible factor prolyl hydroxylase 4
  • P4H with transmembrane domain
  • P4H-TMFLJ20262
  • PH4 hypoxia inducible factor prolyl 4 hydroxylase
  • PH-4
  • PHD4
  • proline 4-hydroxylase
  • prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum)
  • Prolyl hydroxlase domain-containing 4
  • transmembrane prolyl 4-hydroxylase

Background

Prolyl hydroxylase 4 is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the prolyl hydroxylase sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. Prolyl hydroxylase is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, prolyl hydroxylases convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis. Prolyl hydroxylase 4, specifically, catalyzes the post-translational formation of 4-hydroxyproline in HIF alpha proteins. It may function as a cellular oxygen sensor and, under normoxic conditions, may targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitylation complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
AF6394
Species: Hu
Applications: IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
DHP250
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-07388
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
DTM100
Species: Hu
Applications: ELISA
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-83989PEP
Species: Hu
Applications: AC

Publications for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)

There are no publications for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)

There are no reviews for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHD4/HIF Prolyl Hydroxylase 4 Products

Research Areas for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP)

Find related products by research area.

Blogs on PHD4/HIF Prolyl Hydroxylase 4

There are no specific blogs for PHD4/HIF Prolyl Hydroxylase 4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol P4HTM