PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HTM. Source: E. coli
Amino Acid Sequence: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
P4HTM |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen
Background
Prolyl hydroxylase 4 is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the prolyl hydroxylase sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. Prolyl hydroxylase is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, prolyl hydroxylases convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis. Prolyl hydroxylase 4, specifically, catalyzes the post-translational formation of 4-hydroxyproline in HIF alpha proteins. It may function as a cellular oxygen sensor and, under normoxic conditions, may targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitylation complex.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: AC
Publications for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)
There are no publications for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)
There are no reviews for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP) (0)
Additional PHD4/HIF Prolyl Hydroxylase 4 Products
Research Areas for PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP)
Find related products by research area.
|
Blogs on PHD4/HIF Prolyl Hydroxylase 4