![Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining in human lymph node and liver tissues . Corresponding PDCD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88104-img0017.jpg "Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining in human lymph node and liver tissues . Corresponding PDCD1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDCD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western internal validation: NK cell lysate at 1 mg/ml, NSCLC lysate at 1 mg/ml as samples; separated by size; antibody dilution of 1:50; observed molecular weight was 116 kDa; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Flow_Cytometry_16025.jpg)
![Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Immunohistochemistry_17363.jpg)
![Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Dual_RNAscope_ISHIHC_23827.jpg)
![Immunohistochemistry TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM3_AF2365_Immunohistochemistry_23056.jpg)
![Dual RNAscope ISH-IHC Compatible TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM3_AF2365_Dual_RNAscope_ISHIHC_23829.jpg)
![Knockout Validated TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af2365_human-tim-3-affinity-purified-polyclonal-ab-knockout-validated-1562021145510.jpg)
| Publication using NBP1-88104 | Applications | Species |
|---|---|---|
| Duchnowska R, Peksa R, Radecka B et al. Immune response in breast cancer brain metastases and their microenvironment: the role of the PD-1/PD-L axis. Breast Cancer Res 2016-04-27 [PMID: 27117582] |
Secondary Antibodies |
Isotype Controls |
Research Areas for PD-1 Antibody (NBP1-88104)Find related products by research area.
|
|
Unlocking the Potential of Biosimilars in Immuno-Oncology By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach... Read full blog post. |
|
Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ... Read full blog post. |
|
Synthetic Biotic Medicine as Immunotherapy Against Cancer: Evidence From Arginine-Producing Engineered Bacteria By Jamshed Arslan, Pharm D, PhDWhat do nuts, dairy and red meat have in common? In addition to the fact that they are all edible, one of the answers is L-arginine. This amino acid improves T cell’s respons... Read full blog post. |
|
Thomson Reuters Predicts 2016 Nobel Prize Winners Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDCD1 |
![Western Blot: PD-1 Antibody [NBP1-88104] - Analysis in control (vector only transfected HEK293T lysate) and pDCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PD-1-Antibody-Western-Blot-NBP1-88104-img0012.jpg "Western Blot: PD-1 Antibody [NBP1-88104] - Analysis in control (vector only transfected HEK293T lysate) and pDCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/PD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88104-img0019.jpg "Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/PD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88104-img0015.jpg "Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/PD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88104-img0016.jpg "Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PD-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88104-img0018.jpg "Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry PD-L2/B7-DC/PDCD1LG2 Antibody (176611) [Unconjugated]](https://images.novusbio.com/images2/PDL2_MAB1224_Immunohistochemistry_20893.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Agonist Activity CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/CD28_MAB342_Functional_Assay_2393.jpg)
![Immunocytochemistry CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/mab342_human-cd28-mab-clone-37407-immunocytochemistry-31102022134634.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")