![Western Blot: OA1 Antibody [H00004935-B01P] - Analysis of GPR143 expression in transfected 293T cell line by GPR143 polyclonal antibody. Lane 1: GPR143 transfected lysate(46.64 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/OA1-Antibody-Western-Blot-H00004935-B01P-img0004.jpg "Western Blot: OA1 Antibody [H00004935-B01P] - Analysis of GPR143 expression in transfected 293T cell line by GPR143 polyclonal antibody. Lane 1: GPR143 transfected lysate(46.64 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Flow |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GPR143 (NP_000264.1, 1 a.a. - 424 a.a.) full-length human protein. MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL |
| Specificity | Reacts with G protein-coupled receptor 143. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | GPR143 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OA1 Antibody (H00004935-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GPR143 |
| Entrez |
|
| Uniprot |
|
![Flow Cytometry: OA1 Antibody [H00004935-B01P] - Analysis of negative control 293 cells (Black) and GPR143 expressing 293 cells (Green) using GPR143 purified mouse polyclonal antibody.](http://images.novusbio.com/fullsize/OA1-Antibody-Flow-Cytometry-H00004935-B01P-img0003.jpg "Flow Cytometry: OA1 Antibody [H00004935-B01P] - Analysis of negative control 293 cells (Black) and GPR143 expressing 293 cells (Green) using GPR143 purified mouse polyclonal antibody.")
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")