![Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining in human lymph node and skeletal muscle tissues using anti-NUP37 antibody. Corresponding NUP37 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NUP37-Antibody-Immunohistochemistry-Paraffin-NBP2-58005-img0005.jpg "Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining in human lymph node and skeletal muscle tissues using anti-NUP37 antibody. Corresponding NUP37 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NUP37 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUP37 |
![Western Blot: NUP37 Antibody [NBP2-58005] - Analysis using Anti-NUP37 antibody NBP2-58005 (A) shows similar pattern to independent antibody NBP2-55454 (B).](http://images.novusbio.com/fullsize/NUP37-Antibody-Western-Blot-NBP2-58005-img0006.jpg "Western Blot: NUP37 Antibody [NBP2-58005] - Analysis using Anti-NUP37 antibody NBP2-58005 (A) shows similar pattern to independent antibody NBP2-55454 (B).")
![Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/NUP37-Antibody-Immunohistochemistry-Paraffin-NBP2-58005-img0003.jpg "Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/NUP37-Antibody-Immunohistochemistry-Paraffin-NBP2-58005-img0004.jpg "Immunohistochemistry-Paraffin: NUP37 Antibody [NBP2-58005] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![IL-9 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-9 [Unconjugated]")
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")