Home » NSF » NSF Proteins » NSF Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NSF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NSF Recombinant Protein Antigen (NBP2-58843PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NSF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSF.

Source: E. coli

Amino Acid Sequence: EVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NSF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58843.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NSF Recombinant Protein Antigen

  • EC 3.6.4.6
  • NEM-sensitive fusion protein
  • N-ethylmaleimide-sensitive factor
  • N-ethylmaleimide-sensitive factor-like protein
  • N-ethylmaleimide-sensitive fusion protein
  • SKD2
  • vesicle-fusing ATPase
  • Vesicular-fusion protein NSF

Background

N ethylmaleimide sensitive factor (NSF) is an ~83 kDa protein (predicted MW) which was initially isolated based on its ability to restore intercisternal Golgi transport to N ethylmaleimide treated membranes. NSF was subsequently discovered to be involved in a variety of membrane fusion events. NSF is an ATPase with two ATP binding domains that are essential for membrane fusion and homo oligomerization. In order to interact with target membranes, NSF requires another set of soluble proteins called Soluble NSF attachment proteins (SNAPs). NSF has been shown to play a prominent role in synaptic vesicle fusion. Together with synaptotagmin and a SNAP, NSF modulates the interaction of SNAP25, VAMP, and syntaxin, in an ATP dependent manner, to form a complex with a sedimentation coefficient of 20 S. This complex may represent an intermediate involved in synaptic vesicle docking and fusion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NAPA Antibody
NBP1-32493
Western Blot NAPA Antibody
Immunocytochemistry/ Immunofluorescence NAPA Antibody
Immunocytochemistry/ Immunofluorescence NAPA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry VAMP-2 Antibody
Western Blot VAMP-2 Antibody
Western Blot VAMP-2 Antibody
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
VTI1B Antibody
NBP2-33414
Western Blot VTI1B Antibody
Immunohistochemistry-Paraffin VTI1B Antibody
Immunocytochemistry/ Immunofluorescence VTI1B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p97/VCP Antibody
NB100-1558
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Syntaxin 1A
Antibody (2B2F10)
NBP3-15706
Immunohistochemistry-Paraffin Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
mGluR2 Antibody -
BSA Free
NLS892
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence mGluR2 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
SNAP23 Antibody
NBP2-20434
Western Blot SNAP23 Antibody
Immunocytochemistry/ Immunofluorescence SNAP23 Antibody
Western Blot SNAP23 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VAMP3/Cellubrevin
Antibody
NB300-510
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
(11 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Syntaxin-BP1
Antibody [Unconjugate
AF5675
Western Blot Syntaxin-BP1 Antibody [Unconjugated]
Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]
Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(2 Publications)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
NAPG Antibody
NBP1-86101
Western Blot NAPG Antibody
Immunohistochemistry-Paraffin NAPG Antibody
Immunohistochemistry-Paraffin NAPG Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PICK1 Antibody
NB100-41403
Western Blot PICK1 Antibody
Immunohistochemistry-Paraffin PICK1 Antibody
Immunohistochemistry-Paraffin PICK1 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
COMT Antibody
NB100-1780
Western Blot COMT Antibody
Western Blot COMT Antibody
Flow Cytometry COMT Antibody
(3 Publications)
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Syntaxin 4 Antibody
NBP1-87374
Immunocytochemistry/ Immunofluorescence Syntaxin 4 Antibody
Western Blot Syntaxin 4 Antibody
Immunohistochemistry-Paraffin Syntaxin 4 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Proteasome 19S 10B
Antibody
NB100-1483
Western Blot Proteasome 19S 10B Antibody
Immunocytochemistry/ Immunofluorescence Proteasome 19S 10B Antibody
Flow Cytometry Proteasome 19S 10B Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB

Publications for NSF Recombinant Protein Antigen (NBP2-58843PEP) (0)

There are no publications for NSF Recombinant Protein Antigen (NBP2-58843PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSF Recombinant Protein Antigen (NBP2-58843PEP) (0)

There are no reviews for NSF Recombinant Protein Antigen (NBP2-58843PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NSF Recombinant Protein Antigen (NBP2-58843PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NSF Products

Blogs on NSF

There are no specific blogs for NSF, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NSF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NSF