Home » Nrf1 » Nrf1 Proteins » Nrf1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Nrf1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Nrf1 Protein (NBP1-89125PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Nrf1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRF1.

Source: E. coli

Amino Acid Sequence: ATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89125.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nrf1 Recombinant Protein Antigen

  • Alpha palindromic-binding protein
  • ALPHA-PAL
  • EWG
  • HBZ17
  • LCR-F1
  • NFE2L1
  • Nrf1
  • NRF-1
  • nuclear respiratory factor 1
  • TCF11

Background

NRF1 encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

mtTFA Antibody
(18G102B2E11)
NBP1-71648
Western Blot mtTFA Antibody (18G102B2E11)
Knockdown Validated mtTFA Antibody (18G102B2E11)
Western Blot mtTFA Antibody (18G102B2E11)
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
Nuclear Factor
Erythroid 2 Related F ...
NBP2-93792
Immunocytochemistry/ Immunofluorescence Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Nrf2 Antibody
NBP1-32822
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
(4 Reviews)
(71 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
PGC1 alpha
Antibody - BSA Free
NBP1-04676
Western Blot PGC1 alpha Antibody - BSA Free
Immunohistochemistry-Paraffin PGC1 alpha Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGC1 alpha Antibody - BSA Free
(11 Reviews)
(278 Publications)
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
GABPA Antibody
NBP1-32105
Immunocytochemistry/ Immunofluorescence GABPA Antibody
Immunoprecipitation GABPA Antibody
Immunohistochemistry-Paraffin GABPA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Nuclear Factor
Erythroid Derived 2 A ...
NBP1-82580
Immunohistochemistry-Paraffin Nuclear Factor Erythroid Derived 2 Antibody
Immunohistochemistry-Paraffin Nuclear Factor Erythroid Derived 2 Antibody
Immunohistochemistry-Paraffin Nuclear Factor Erythroid Derived 2 Antibody
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NKRF Antibody
NBP3-29103
Immunohistochemistry NKRF Antibody
Species: Hu
Applications: IHC, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/ Immunofluorescence CPOX Antibody (36B10) - BSA Free
Western Blot CPOX Antibody (36B10) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for Nrf1 Protein (NBP1-89125PEP) (0)

There are no publications for Nrf1 Protein (NBP1-89125PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nrf1 Protein (NBP1-89125PEP) (0)

There are no reviews for Nrf1 Protein (NBP1-89125PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nrf1 Protein (NBP1-89125PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nrf1 Products

Research Areas for Nrf1 Protein (NBP1-89125PEP)

Find related products by research area.

Blogs on Nrf1.

Check out the latest blog posts on Nrf1.
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.
PGC-1 alpha: Roles in Mitochondrial Biogenesis and Disease
An important aspect of mitochondria maintenance includes biogenesis to replenish damaged and degraded mitochondrial structures. The regulation of mitochondrial biogenesis is very complex and numerous genes regulate and synchronize protein synthesis fr...  Read full blog post.
Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha NBP1-04676) and NIX (BNIP3L NBP1-88558) were visualized via western blotting. Loading control is beta-actin. n = 5. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105/) licensed under a CC-BY license.
PGC1 alpha Antibody - BSA Free
NBP1-04676
Untreated (-) and treated (+) RAW264.7 whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nrf1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NRF1